PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna18416.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family MYB
Protein Properties Length: 959aa    MW: 106555 Da    PI: 5.2775
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna18416.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.72.1e-16363409148
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                              +g WT++Ede l +av+++ g++Wk+Ia+ +   R++ qc +rwqk+l
  mrna18416.1-v1.0-hybrid 363 KGGWTPQEDETLRNAVEKYKGKNWKKIAQNFT-DRSEVQCLHRWQKVL 409
                              688****************************9.************986 PP

2Myb_DNA-binding61.12.3e-19415461148
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                              +g+WT+eEd+++v++v+++G+  W++I++ ++ gR +kqc++rw+++l
  mrna18416.1-v1.0-hybrid 415 KGPWTQEEDDKIVELVAKYGPTKWSLISKSLP-GRIGKQCRERWHNHL 461
                              79******************************.*************97 PP

3Myb_DNA-binding49.68.9e-16467510146
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                              r +WT  E++ l +a++++G++ W+ Ia+ ++ gRt++ +k++w++
  mrna18416.1-v1.0-hybrid 467 REAWTLVEELALMHAHRMHGNK-WAEIAKALP-GRTDNAIKNHWNS 510
                              789*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.10.280.103.0E-1166247IPR003428Mitochondrial glycoprotein
PfamPF023304.5E-1190245IPR003428Mitochondrial glycoprotein
SuperFamilySSF545296.02E-997131IPR003428Mitochondrial glycoprotein
SuperFamilySSF545296.02E-9173251IPR003428Mitochondrial glycoprotein
PROSITE profilePS5129415.682358409IPR017930Myb domain
SMARTSM007179.7E-15362411IPR001005SANT/Myb domain
PfamPF002496.0E-15363409IPR001005SANT/Myb domain
SuperFamilySSF466892.23E-15364419IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.0E-18365414IPR009057Homeodomain-like
CDDcd001673.16E-13366409No hitNo description
PROSITE profilePS5129432.789410465IPR017930Myb domain
SuperFamilySSF466891.54E-30412508IPR009057Homeodomain-like
SMARTSM007172.7E-18414463IPR001005SANT/Myb domain
PfamPF002491.7E-18415461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-27415464IPR009057Homeodomain-like
CDDcd001675.14E-16417461No hitNo description
Gene3DG3DSA:1.10.10.604.8E-22465516IPR009057Homeodomain-like
PROSITE profilePS5129421.07466516IPR017930Myb domain
SMARTSM007176.0E-15466514IPR001005SANT/Myb domain
PfamPF002492.7E-14467510IPR001005SANT/Myb domain
CDDcd001676.82E-11469512No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005759Cellular Componentmitochondrial matrix
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 959 aa     Download sequence    Send to blast
MEKMVAQPCS TDLKMALFSS GSRKLPAYSS SIVFLPVCSI RSARVCAKRR EVNKTNPSPA  60
SPKLKATQDL INGLKCEIAN VQEDLERFHA VEGSDEFPFE IITRSGYGLK TKETYLQREL  120
DDEVIRVSAE YETDEDEDED EEDDDEDDEV EEDDDDDEFD DEVEEDDEEE DSGIAMKVNI  180
FQKSTGKQLK LDVTSFPDEI RVDHFSIKKP EQYYLDVTKT GGKYLANLQK ELVKYLEVKG  240
VTPKTIELWK ASLKNKIGRE SVVNMKGFRA FMEKSNVFTK KKGCAIDSMS FNLIPPTSSP  300
PEKGRSEVPI EERCLVNKQS TAASSSDSEC SESPILKSPG IGSSPAEASP VNKRITGPIR  360
RAKGGWTPQE DETLRNAVEK YKGKNWKKIA QNFTDRSEVQ CLHRWQKVLN PELVKGPWTQ  420
EEDDKIVELV AKYGPTKWSL ISKSLPGRIG KQCRERWHNH LNPDIKREAW TLVEELALMH  480
AHRMHGNKWA EIAKALPGRT DNAIKNHWNS SLKKKLDFYL ATGQLPPPPK NSYLNVPKET  540
NRSTATKRLL VGSDKGSDST ARTLPGNADK RRKIDEDGND HLQSSEPLDM DMCAFYLANG  600
QLPPVSKNFF PNGAKETNRT TATTRLLVDS DKGSESSAHT LSGNADMCKV DDNGKDQLQS  660
SGSEDMCGSS SILPDEHADS EVMDRRLRLS LMDPSCSNSE SLPTFSNCGV NSKPQIENSD  720
INSDPKYENS EFNSQQVEDK VESSTVPVQT PSYGSLYYEP PPVDSSIPFD SGISNLHYLQ  780
HEYESSPNLS PISFFTPPTA KSSGLGNRSP ESILKIAAKT FPNTPSILRK RKSAQGHLPP  840
NKLRIVDSES VRETVTVPEG QERNKNSVEL SGSQDVSLFD SPTSHGISTT GPNGKAFNAS  900
PPYRLRSRRT AVFKSVEKQL QFTCEEEYAG NSKPVELSAN GGSAVTKDCS HATKMEIT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C1e-643625165159MYB PROTO-ONCOGENE PROTEIN
1h89_C1e-643625165159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00482DAPTransfer from AT5G02320Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011466561.10.0PREDICTED: transcriptional activator Myb
TrEMBLM5W7C50.0M5W7C5_PRUPE; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF66163449
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02320.21e-119myb domain protein 3r-5